PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_13150_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 222aa    MW: 25008.7 Da    PI: 10.1357
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_13150_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.71.3e-221862549
                    SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    n+sn qvtfskRr g++KKA+EL++LC+aeva+i+fs+  k++ +
  Neem_13150_f_1 18 NESNLQVTFSKRRSGLFKKASELCTLCGAEVAIIVFSPGKKVFSF 62
                    89************************************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.633666IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-31665IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-26782IPR002100Transcription factor, MADS-box
CDDcd002654.15E-34776No hitNo description
PRINTSPR004041.0E-18828IPR002100Transcription factor, MADS-box
PfamPF003191.5E-241762IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-182843IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-184364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009960Biological Processendosperm development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MTRKNKGRQK VEMVKMPNES NLQVTFSKRR SGLFKKASEL CTLCGAEVAI IVFSPGKKVF  60
SFGHPCVESV VERFLTRNPP QISGTMQLIE AHRNASVREL NMQLTQVLNQ LEVEKKRGEE  120
LNQMRKASQA QCWWEAPIDE LNLPQLEQLK MSLEELKRNV GKQAEKILIQ SSNPPPQFFA  180
GSSSNGGINL PFDHHAKNNT GFNPNMTPHG YNNNPGLGRG FY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A6e-16791186Myocyte-specific enhancer factor 2A
3kov_B6e-16791186Myocyte-specific enhancer factor 2A
3kov_I6e-16791186Myocyte-specific enhancer factor 2A
3kov_J6e-16791186Myocyte-specific enhancer factor 2A
3p57_A6e-16791186Myocyte-specific enhancer factor 2A
3p57_B6e-16791186Myocyte-specific enhancer factor 2A
3p57_C6e-16791186Myocyte-specific enhancer factor 2A
3p57_D6e-16791186Myocyte-specific enhancer factor 2A
3p57_I6e-16791186Myocyte-specific enhancer factor 2A
3p57_J6e-16791186Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006422731.11e-133hypothetical protein CICLE_v10030142mg
SwissprotQ9FKK23e-72AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A067EEZ41e-134A0A067EEZ4_CITSI; Uncharacterized protein
STRINGPOPTR_0009s08750.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-73AGAMOUS-like 62